PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_9136_iso_6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 278aa    MW: 31342.1 Da    PI: 7.0839
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_9136_iso_6genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.6e-161260148
                                         TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                                         +g+W++eEd +l+d+++++G+g +W + + + g++R++k+c++rw++yl
  cra_locus_9136_iso_6_len_1056_ver_3 12 KGPWSPEEDAKLKDYIEKHGTGgNWIALPLKAGLKRCGKSCRLRWLNYL 60
                                         79*********************************************97 PP

2Myb_DNA-binding36.41.2e-1167109246
                                          SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                      Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                          g ++ +Ed ++  ++   G++ W+ Ia+ ++ gRt++++k++w++
  cra_locus_9136_iso_6_len_1056_ver_3  67 GDFSDDEDRIICTLFSTIGSR-WSIIAAQLP-GRTDNDIKNYWNT 109
                                          679******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.62760IPR017930Myb domain
SuperFamilySSF466893.32E-279107IPR009057Homeodomain-like
SMARTSM007172.4E-121162IPR001005SANT/Myb domain
PfamPF002492.4E-151260IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-241367IPR009057Homeodomain-like
CDDcd001673.08E-91460No hitNo description
PROSITE profilePS5129421.39461115IPR017930Myb domain
SMARTSM007172.5E-1165113IPR001005SANT/Myb domain
PfamPF002491.9E-1067109IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2268115IPR009057Homeodomain-like
CDDcd001671.14E-769111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
LAPCCDKANV KKGPWSPEED AKLKDYIEKH GTGGNWIALP LKAGLKRCGK SCRLRWLNYL  60
RPNIKHGDFS DDEDRIICTL FSTIGSRWSI IAAQLPGRTD NDIKNYWNTK LKKKLMGMSQ  120
KRSQNSITPN SILLDHQSLS LTSSSSSLPY PTLSFTGYQN YSIPSTNNPP SVVIQGQEGN  180
YMMNSSIHHY QDHNSFLRFG SEVAAAAAAS SSSSDDGSSI FINRFEDDQQ KPIINYDQNP  240
SLDCSLEEIK QLISTNLTFN NNFFLDEIKI EEDKFTYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26121157108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004304464.14e-87PREDICTED: transcription factor RAX2
TrEMBLA0A068UF156e-90A0A068UF15_COFCA; Uncharacterized protein
STRINGGLYMA19G36830.12e-83(Glycine max)